PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001231-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 497aa    MW: 54915.6 Da    PI: 7.5627
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001231-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-1660104147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r rW++eE+++++da k++G   W++I +++g ++t+ q++s+ qk+
  WALNUT_00001231-RA  60 RERWSEEEHKKFLDALKMYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 104
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.16E-1654107IPR009057Homeodomain-like
PROSITE profilePS5129420.69355109IPR017930Myb domain
TIGRFAMsTIGR015573.8E-1658107IPR006447Myb domain, plants
SMARTSM007176.3E-1359107IPR001005SANT/Myb domain
PfamPF002499.9E-1460103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-960100IPR009057Homeodomain-like
CDDcd001676.59E-1062105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MAIQDQSVGT RSRSVLQGSN EVSLSSGLHS VTGAQLRDRF SSGNDYATKV RKPYTITKQR  60
ERWSEEEHKK FLDALKMYGR AWRRIEEHVG TKTAVQIRSH AQKFFSKVVR DSNGSNASSE  120
PIEIPPPRPK RKPMHPYPRK LVIPPNKEIS TLEQPLRSAS PNLSVSEQEN HSPTSVLSAV  180
GSEAVGSPDL DSPNNSLSPV SSAADVQLGG LVLPEPNQST DRSASPSPAL MTVGSVSDQQ  240
LPVKFELFPK ENACTKEVTS EEASPRQLKL FGRTVLVTDS HRPSCPSTGT SKPIPADMHE  300
EKVVEPLPVN SEPVKSMPGN TECVWSHLPH VPNDALYFMQ CQRKSLNLLE NSSATPIPWW  360
TFCGGLPLPF MPFHKVDPSG GAYGDSALGE VHDKEVRKEG SWTGSNTGSM HDGENGDRCS  420
EAETQSRPFF LRNENQERSM IFQFRPSEKS AFSDLSMSPE KCVKGFVPYK RCMAERETQS  480
STITGQEGDE KRIRLCL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267976.20.0PREDICTED: protein REVEILLE 1
TrEMBLA5C7G80.0A5C7G8_VITVI; Putative uncharacterized protein
STRINGVIT_04s0079g00410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.19e-73MYB_related family protein